SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000016124 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000016124
Domain Number 1 Region: 31-73
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000106
Family SAM (sterile alpha motif) domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000016124   Gene: ENSAPLG00000016237   Transcript: ENSAPLT00000016937
Sequence length 305
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743761.1:10463:15012:-1 gene:ENSAPLG00000016237 transcript:ENSAPLT00000016937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFGPFWHALSAATSEWIQFKEAGIPPGPAVNYAVMFVDNRIQKNMLLDLNKEIMNELGIT
IVGDIIAILKHAKVVYRQVGASPTSLGLGLTGFWTGVLMELAPPVPPRCSFGVNSCCFSF
SLFFSPLLSGSPAPVPAKRRRVTAEMEGKYVITMPKGTTPRTKKILEQQAKTPPGLQRTS
VFDRLGAETKSDAVAGKETREGVSLLLRKRGEGKASTQNGGGGTQKNAESDDDDDEGSVL
PYAGVLKKPQKDAPETGKIIKAKAQTSEPPRRRAGGKTQPPQNSPVAQDSSVSSSRSKPV
PKMGI
Download sequence
Identical sequences U3J9E6
ENSAPLP00000016124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]