SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000016168 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000016168
Domain Number 1 Region: 499-823
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 9.59e-53
Family Diacylglycerol kinase-like 0.011
Further Details:      
 
Domain Number 2 Region: 88-148
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000872
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0018
Further Details:      
 
Domain Number 3 Region: 305-385
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000093
Family Ras-binding domain, RBD 0.011
Further Details:      
 
Domain Number 4 Region: 28-79
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000179
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.026
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000016168
Domain Number - Region: 210-261
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00354
Family Ras-binding domain, RBD 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000016168   Gene: ENSAPLG00000016272   Transcript: ENSAPLT00000016981
Sequence length 855
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB751155.1:213196:274769:1 gene:ENSAPLG00000016272 transcript:ENSAPLT00000016981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCNFMSHEKCLKNVKIPCSCIAPSLVRVPVAHCFGPPGHYKRKFCTVCRKSLESPAFRCE
VCELHVHTDCILFACSDCRQCHQDGHQDQDTYHHHWREGNLPSGARCEVCKKTCGSSEVL
SGMRCEWCGILAHAACYIIVTPECTFGRLRNMILPPSCVQLFSRNFSKLHCFRISENLQA
ESEGNDEPVNGSPGRGESREKQMLPESGKQTLKIFDGNDAVKRNQFRLISIPRIAKNEEV
VEAALRAYYINDDQQEYELQTFTQQALLSDDVINRNDAAEDSNSGSVFRESVPEAWIIRA
KPKDEEVIRIYPAWLKVGMAYVSLRVNKESTTQSVIKEVLPLLGRQTECLQNFKLVEVLM
GSKQALVQRMVLDSQELILNRLKDIRKTSIRQMNQTRFYVVENSKSIVRVNLFIGGLPPQ
LSPEEYTNILKDELAIKTNVVSVSHVYQAQGAVVLEISCFSEAERIYMLVKDTTVNDKPL
NAVVIPEVMASKIPQNCWPLLVFVNPKSGGLKGRDLLHSFRKLLNPHQVFELTNGGPLPG
FHTFSKVPSFRVLVCGGDGTVGWVLGALEEIRHKLVCSEPSVAILPLGTGNDLGRVLRWG
AGYSGEEDPYSVLISVDEADDVLMDRWTILLDAEEPADGAENGVAEPEPPKIVQMNNYCG
LGIDAELSLDFHHAREEEPGKFNSRFHNKGVYVKVGLQKISHTRNLHKDIKLQVDQREVE
LPSIEGLIFINIPSWGSGADLWGSDSDDRFEKPRIDDGLLEVVGVTGVVHMGQVQGGFRS
GIRIAQGSYFRVTLLKPIPVQVDGEPWIQAPGQIIISAAGPKVHMLKKSKQKQKKTGSLK
EMRVDSMASGDLCSE
Download sequence
Identical sequences U3J9J0
ENSAPLP00000016168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]