SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000016171 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000016171
Domain Number 1 Region: 22-395
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.92e-122
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00000514
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000016171   Gene: ENSAPLG00000016263   Transcript: ENSAPLT00000016984
Sequence length 540
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742655.1:758838:828134:1 gene:ENSAPLG00000016263 transcript:ENSAPLT00000016984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVTENGDVTAGKPNEEKTYKKTASSAIKGAIQLGIGYTVGNLTSKPDRDVLMQDFYVV
ESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNP
GASGSLFFVTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGG
INIRIVVMNNVLPRALKMHFTYDLKGSTYKRRASRKEREKSNPTFKDLDFLQDMHEGLYF
DSETHSALMKTLQRDCRVLESFKIMDYSLLLGIHILNSHMKEKEGETSQNATDAKRPGGQ
KVLYSTAMESIQGPGKSGDSVVTEATNTMGGIPAKSHKGEKLLLFMGIIDILQSYRLMKK
LEHSWKALVYDGDTVSVHRPSFYADRFLKFMSTRVFKKVQALRSSPSKKRCNSITALKAT
SQEIVYAGSQDWKDEKHGIITEGQSYSSLDEEVLSSRHRPDLVPSTPSLFEAASLATTIS
SSSLNVDERYQRDQHMLYSSSKGLPSSSTYTLEDSAIYLTSEQSTLETENDNASVLDVYL
Download sequence
Identical sequences U3J9J3
ENSAPLP00000016171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]