SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000016197 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000016197
Domain Number 1 Region: 351-430
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000272
Family C-terminal fragment of elongation factor SelB 0.079
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000016197
Domain Number - Region: 163-269
Classification Level Classification E-value
Superfamily TPR-like 0.0024
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000016197   Gene: ENSAPLG00000016288   Transcript: ENSAPLT00000017010
Sequence length 487
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742551.1:551095:558905:1 gene:ENSAPLG00000016288 transcript:ENSAPLT00000017010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISYIYHILLFQGAVEPMQIDVDPQEDQQNAPDINYVVENPTLDLEQYASSYSGLMRIERL
QFIADHCPQLRVEALKMALSFVQRTFNVDVYEEIHRKLSEATRELQNTPDAVPDSGIEPP
PLDTAWVEATRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGDHYLDCGDLSNALKC
YSRARDYCTSAKHVINMCLNVIKVSVYLQNWSHVLSYVSKAESTPEIAEQRGERDSQTQA
ILTKLKCAAGLAELAARKYKQAAKCFLLASFDHCDFPELLSPSNVAVYGGLCALATFDRQ
ELQRNVISSSSFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKDNLLLDMYLAPHVRT
LYTQIRNRALIQYFSPYVSADMHKMATAFNTTVAALEDELTQLILEGLINARIDSHSKIL
YARDVDQRSTTFEKSLLMGKEFQRRAKAMILRAAVLRNQIHVKSPPREGSQGELTPANSQ
SRMSTNM
Download sequence
Identical sequences U3J9L9
ENSAPLP00000016197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]