SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000016198 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000016198
Domain Number 1 Region: 364-484
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.51e-47
Family MBT repeat 0.0000428
Further Details:      
 
Domain Number 2 Region: 253-361
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.89e-44
Family MBT repeat 0.00000386
Further Details:      
 
Domain Number 3 Region: 469-593
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.73e-36
Family MBT repeat 0.0000262
Further Details:      
 
Domain Number 4 Region: 805-879
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.67e-16
Family SAM (sterile alpha motif) domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000016198   Gene: ENSAPLG00000016290   Transcript: ENSAPLT00000017011
Sequence length 887
Comment pep:novel scaffold:BGI_duck_1.0:KB744461.1:7372:44473:1 gene:ENSAPLG00000016290 transcript:ENSAPLT00000017011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSERIVTIPPPDYDLLNALDWKDGIGTLPGSNIQFFLNEFGMLEILTEAEAEAIKALSAS
AINASPTSQDHPTSPISPQGAIRMSASTGKETMKMLLNKKQIVFFFFASAVSKDNLPCSV
FQTYGQMDCFANGKFCTQTASQQHRDRNRGNSRNPNVGIGCQVNEINRPAKRLRRKRRLL
LESEDDEENADEDEVNKATWRALEKNKSNNMKSRRNTKPIKQVVPAKKKVWNWVSYLEEE
RMPAAPLKLFREYQSFPQGRNGFKVGMKLEGLDPEHPSRFCVLTVAEVQGYRMRLHFDGY
PECYDFWVNADSSDIHPVGWCEKTSHKLLPPKGFKEGEFNWASYLKNCKAQAAPKSLFKT
LSTPVTPSGFRLGMKLEAVDKKNPSLMCVATITDMVDNRLLIHFDNWDENYDYWCEASSP
YIRPVGYCQETGTPLTTPPGYKDPKAFSWEKYLEETNSQAAPARAFKLRPAHGFQVNMKL
EAVDKRNPILIRVATIIDKDDHRIKIHFDGWDHNYDFWVDADSPDVHPVGWCAKTGHALQ
VPLGAADPVGTVGQACPTPGCHGIGHVRGPRYGTHYTLVGCPYSDVNLSRENSLQDRLSG
ERPSPANSLPKAKRIETPAPVLLGTGGSSQEDSPHSRKSAQESEKSCQSSVHSLSEQSEN
NQEKDWMEEESSADIKAKPKNTTAYSPEMARGSCSLGCNHSAGREEKENQVKKTIKPFQR
TELTRLLGGFNMVISLQSKIAKQAQTGAALLSPQLVRSRQPVKNPDFDLQQALHQSIFMP
SLTSNPTHRLHLCWEQHCKLLPEVSGLTAKHVAKWTVEEVASFIQRLPGCKEQASVFREE
QIDGEAFLLLNQTDIVKILGIKLGPALKIYNAILMLKSAEEESRRHL
Download sequence
Identical sequences U3J9M0
ENSAPLP00000016198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]