SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000016296 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000016296
Domain Number 1 Region: 1-171
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.81e-70
Family Ephrin receptor ligand binding domain 0.00000135
Further Details:      
 
Domain Number 2 Region: 577-852
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.34e-64
Family Protein kinases, catalytic subunit 0.0000000196
Further Details:      
 
Domain Number 3 Region: 299-332,359-499
Classification Level Classification E-value
Superfamily Fibronectin type III 7.9e-31
Family Fibronectin type III 0.00014
Further Details:      
 
Domain Number 4 Region: 875-948
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.36e-18
Family SAM (sterile alpha motif) domain 0.00052
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000016296
Domain Number - Region: 227-296,343-350
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000126
Family Growth factor receptor domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000016296   Gene: ENSAPLG00000016384   Transcript: ENSAPLT00000017112
Sequence length 950
Comment pep:novel scaffold:BGI_duck_1.0:KB744367.1:235973:271243:1 gene:ENSAPLG00000016384 transcript:ENSAPLT00000017112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVLLDSKESQAELGWTSHPSNGWEEISGVDENYKPIRTYQVCNVMEPNQNNWLQTGWIAR
RDGQRIFIELKFTLRDCNSIPGVMGTCKETFNLYYVESDSDLGRNIHESKHTKIDTIAAD
ESFTQGDLGERKMKLNTELREIGHLSKQGFHLGFQDVGACVALVSVRVYYKKCLATLQNL
ALFPDTVAEAAFATLVEVKGACVEHAQVDVDNPPRMHCSAEGEWLVPIGKCLCGPGFEER
DGRCRACLPGFYKLSLRLPLCSPCPEHSFTHEEASTFCSCQKNYSRSPSDPPSASCTRPP
SAPRDLVYSLRRSSLVLQWSAPADAGGRSSLWCGRCPAARGGCEQCGSGVGFVPQQTGLV
ERTVTLVNLLPHANYTIRVAALNGVSAFSAGQQYAEVNVSTGLAAPTPVTDIRTDKIEQK
SISLSWQEPGFPTTNSTEYEVKYYEKDQRDQSYSTVKTTSTAVTVNNLKPGTLYIFQIRT
SSSQDYGNYSPSIEVETLAELTVASSEQNPVLIIAVVAIAGLTVLVSMVIGVMVWRRQCG
YSKASQDGDEELYFHFKIPTRRTYIDPDTCEDPMQAVHLFAKELDNASIKIERIIGTGEF
GEICRGCLKLPSKRELPVAIQTLRAGCSAKQQRCFLAEACTMGQFDHANVIRLEGVITRG
NTMMIVTEYMGNGVLDSFLRKHEGQFTSTQLITMLQGIASGMKYLAEMGYIHKSLAAHKV
LVNSSLACKITGFRQPQEDKMETIFSTMRGKSLVLWSAPEAIQYHHFSPASDVWSFGIVM
WEVMSYGERPYWDMSHQDVMKAVEDGFRLPAPANCQPPLHQLMLDCWQKDRSQRPKFSHI
HDVLSKMVQSPQPQPCARSRGAAVPLAERSFAAFPAFSSVGEWLEAIEMGRYRDNFTAAG
YCYLESVARMTAQDVLSLGITLAEHQKIILSGIQTLRAQVIQMHGRGVQV
Download sequence
Identical sequences U3J9W8
ENSAPLP00000016296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]