SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000016317 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000016317
Domain Number 1 Region: 41-242
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000666
Further Details:      
 
Domain Number 2 Region: 12-48
Classification Level Classification E-value
Superfamily PH domain-like 0.00000214
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000016317
Domain Number - Region: 499-580
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00324
Family FCH domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000016317   Gene: ENSAPLG00000016416   Transcript: ENSAPLT00000017133
Sequence length 597
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743335.1:811185:849617:1 gene:ENSAPLG00000016416 transcript:ENSAPLT00000017133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGAGDREKMPVNHEAFLLMANSQNEMEDWVKAIRRVIWAPFGGGIFGQRLEDTVQYERKY
GQRLAPLLVEQCVDFIRERGLTEEGLFRMPGQANLVKDLQDSFDCGEKPLFDSNTDVHTV
ASLLKLYLRELPEPVIPFAKYEDFLSCGQLLSKDEGEGTQELVKQVKNLPQANYNLLKYI
CKFLDEVQAHSSINKMSVQNLATVFGPNILRPKMEDPVTMMEGTSLVQHLMTVLISEQGR
IFAVPQADVPGSQLEIRPMRPRNTVEWISEEDGEDRSESCVPSPADSPSGNAVAPEATPG
PVVNNTSPERSSKLTQPATSPSKRVQTLPPWKYSFRQPGARSVSPKLGSSSLDIPNLSSS
GNWLMNGLYSLRGHRRTASGERMKDSCSSQRLSTYDNVPSSSLSLSTHSMASTTWSTSSC
EISVVDSVSSCPACRASDSSALSSLQTEWMTQGSLSQSEVKTADLENSIDRFDVCSSSSE
HSNPAAASRDSVKCSRALQSLVVELKTELSKQRTEYETSIKRIEETSSDLRKQVVRLEEE
LDQERKKYTMLEIKLRNSERAREDAEKRNHLLQKEMEEFFSTLGCLTVGSRSAKVPK
Download sequence
Identical sequences U3J9Y9
ENSAPLP00000016317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]