SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000016318 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000016318
Domain Number 1 Region: 393-536
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-38
Family Third domain of FERM 0.00000434
Further Details:      
 
Domain Number 2 Region: 289-394
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-36
Family Second domain of FERM 0.00000117
Further Details:      
 
Domain Number 3 Region: 208-288
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.48e-26
Family First domain of FERM 0.00002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000016318   Gene: ENSAPLG00000016409   Transcript: ENSAPLT00000017134
Sequence length 865
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744461.1:83636:130197:-1 gene:ENSAPLG00000016409 transcript:ENSAPLT00000017134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEKGPAADAESSEQQQAKEEEEGAAETPKGEASPEEGAQQAAEGQKQKASGGDTQEEP
GKKERRAAEGRGLSRLFSSFLRRPKSQVSEEDKDPDVPTEGGGDQKDAGLGASPDEEILV
KAPIAAPEPELKTDPSLDLHSLSSAETQPAQEERREDQEPDSRDLEGKEGGEAKEECTKP
EPKQETPETKADKDLKAAQRAVKRHRNMYCKVVLLDDTIFECAVDKHAKGQDLLKKVCDH
LNLLEEDYFGLAIWDTPTSRTWLDPAKEIKKQVHGGPWDFTFNVKFYPPDPAQLTEDITR
YYLCLQLRQDIVTGRLPCSFATLALLGSYTVQSELGDYDPDLHSADYISEFKLAPNQTKE
LEEKVMELHKTYRSMTPAQADLEFLENAKKLSMYGVDLHQAKDLEGVDITLGVCSSGLLV
YKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKVCVE
HHTFFRLTSTEAIPKSRFLALGSKFRYSGRTQAQTRQASAMIDRPAPQFERTASKRASRS
LDGAVAVITPERSPRPTSAPAIAQSHLAEAVPAKPDAKEAIAVSKAEKEAVKAETKREEI
PPERAKAEPADASKVRKTHIEVTVPTTNGDQPQQQPAEKEEELIRMRKKRSKRLDGENIY
IRHSNLMLEDLDKTQEEIKKHHANISELKKNFMESVPEPRPSEWDKRLSTHSPFRTLNVN
GQIPTGADGPPLVKTQTVTISDVSNAVKSEIPTKEVPIVHTETKTITYEAAQTDGGNGDL
DPGILLTAQTITSETTSSTTTTQITKTVKGGISETRIEKRIVITGDADVDHDQVLAQAIK
AAKEQHPDMSVTKVVVHQETEIAEE
Download sequence
Identical sequences U3J9Z0
ENSAPLP00000016318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]