SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000000882 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000000882
Domain Number 1 Region: 2146-2431
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.4e-95
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000213
Further Details:      
 
Domain Number 2 Region: 663-769
Classification Level Classification E-value
Superfamily Second domain of FERM 7.2e-31
Family Second domain of FERM 0.00035
Further Details:      
 
Domain Number 3 Region: 770-882
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-28
Family Third domain of FERM 0.0042
Further Details:      
 
Domain Number 4 Region: 1342-1447
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-27
Family PDZ domain 0.00042
Further Details:      
 
Domain Number 5 Region: 1088-1181
Classification Level Classification E-value
Superfamily PDZ domain-like 9.46e-25
Family PDZ domain 0.0083
Further Details:      
 
Domain Number 6 Region: 1477-1580
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-21
Family PDZ domain 0.049
Further Details:      
 
Domain Number 7 Region: 1840-1935
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-18
Family PDZ domain 0.021
Further Details:      
 
Domain Number 8 Region: 569-660
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.81e-17
Family First domain of FERM 0.012
Further Details:      
 
Domain Number 9 Region: 1742-1834
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-17
Family PDZ domain 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000000882
Domain Number - Region: 2-146
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000316
Family Protein kinases, catalytic subunit 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000000882   Gene: ENSAPLG00000001314   Transcript: ENSAPLT00000001453
Sequence length 2434
Comment pep:novel scaffold:BGI_duck_1.0:KB743335.1:922094:983808:1 gene:ENSAPLG00000001314 transcript:ENSAPLT00000001453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTLAEVLWAKGSPLEEEDIWALLYLATVQLLEDLHKVGFSDPAIRVLCPWSVLLSAEGNL
SFQNNAPQTEAIPFSAPELLHRQNKNQCIGLTKMLVYSLGMTLYWSADYQVPPNQSLQLS
DQLHSLLLTLCEDLPHKRLSPESILEACEAHQKESSSLPVNVYIKKMVQFVVGSVSEVER
VATEDSTASQLHRSHVIRRRLHEKILDASPPSSQMNLHRGPANQITFRNKGTNAEIHCGS
HQSGSFPNDLNHSVGGNSNTSRKGTCTFIFKLESELGMPRQDVYTAQKQKAPVAQMSLTS
PKSRLIILLPPSMSLHEKQSPFSCCGRDSGNMAKKKKGAYCFIKSLPRDISQRKRIYPGE
NKTTTKNHTTCRVASHPSVLRMSKVGVLVQLLLILSSCEEKLTYHSSIYHLYHYVRTVLP
LNFSFHIFRHSNADPFSSSRVIPGRVTQTHRSWDPTLSESRTQSSYKLFINRVKLASVCR
AMAFTQRRLSCQVWHPAGRVTGSTFSVSTKDYTAAAASQKCLFQRKEKIFLFSGPEFIIL
SSEPPVTLQLPGSIVLSQTKKGKSYLSQRDLNVILLNGQCLEVQCDVKSKARDVFNTVVA
YANLVEHFYFGLAYLKGKEFFFLDDDTKLYKVAPEGWNDQPKKKTSIINFTLFLRIKFFV
NHFNIIQHGLTRHQFYLQLRKDILEERLYCSDETALKLGALALQAELGNYASEVHGKSYF
RVEDYIPASRIEKMTLAYVQRELAKLHRMNRSLFEDEAELEFLKVTQQLPEYGVLFHRVS
QEKKGAGGDIILGICAKGIIVYEVKNHTRIASLRFQWRETERISAHRKKFMIESSFSGKK
HTFITDTAKTCKYLLDLCSAQHKFNAQMNSRQLRQTSSDSFLHTLNFYNMQFIKILRFKL
YRAVHFICLCGKRVQKARQKLLKKHEHLALIQRLSRSENVLYGANLENLSAGMMSKSCDN
LSVETGNRTRDKSNLARYQQCKHRQEGNNLTACTQLRKKHRGKSFVISTSGLSQSEMHIN
LNGKQRSYDYLSIHSTQNTISGEYDNHEERRYSYICMVSIPGNSTMSSSHLVLAPGSPAI
QKEVLLSGLEREIICVSLKRDPKNGFGFVIIGGENVGKLDLGIFIASIIPGGPADRAGNI
KPGGRLISVNNISLEGVSFNTAVKIIQNSPDEVELIISQPKGIKANIFAGYGVLAINSGH
WYLLGSVSMKKSNQLWALFFTAKYQYGFADIYEEGLNEEKSLSRGNSTSGYEISCVDSGR
KKIQDCHTALPKEKDPNIDELEKALSWSLAPKLGPRIPVLSSDSLDVEGYKCYHSRRTLT
AGSKPLYLLETHSLFLHEADSSHLPHPAETISNEIYTVELVKEDGTFGISVTGGINTSVP
LGGIYVKSIIPRGPADKDGQIKIGDRLLEVDGISLCGLTHKQAVENLKKSGQVAKLVLER
GHHPPAQPCLSANDGKEDQCAVVSVATSFTDGTKDYCFLTDDNIFEVKLTKNSGGLGFSV
LQMEGDGCEHLGGVIVRIKRLFPGQPAEENGEIEVGDIILAVNGTSTQGLFYQDVLHLLR
GAPPEVILLLCRPPKGVLPEIEQCVPTPAPSPVKEFVAEMPGSPEAGNSLDRSTSDGGST
SPDLEDCLDSPVAADFSEPPEEDSSTYEEQEAESQDMSIQRLMPPRESSYKDLWKFHQEA
ASSEAFHSLEEEVKQNCYSPCELGCAERSGGAITAIHTFSSSLTREETSFTLMKISIARK
IMDSSQEEMEVFVTLTRSENNGYGFSVVLNKVDNCLYVDEILHEPALSDGRLRRGDRLIM
VNGIDVTSLPCNEALTLLHNSPPDLHLVVGRAGSDPCPAVRPDDIPEITLTKGANGQLGL
KLTGGAGSKLQGIYVLEIVPGSPASVEGSLQPRDQILYICGLWTEGISLDDAVRVCEAAT
QNVQIKATRNGNPVVPIDQLFCFSLPSFSRFHAIQDTGPQGRNAQDPQRYFKQTKAVLGR
RSCESLAAEDSGTATVGLSEEADLDETKVNKFQGRRIQPDVQQANIIKSILRKEDEEAPL
MGDQRIISQKCAGCEGCRRQSQQSESDSWNNEDDDMPHRISILPRSNHAKNSLVSLMTAM
THKSNCDEQIAKEEMSKGNGDTNFQETVGNSRAFVSEDELIHLINFKPSLTGVCPRTGVR
GLIRGLQTRIENQEVLKEFMALEHVKPTEDCRTGKAQENRDKNRYQDILPYDKTRVPLGE
NKGYINASYIRMKVGEEEHFFIITQGPLPSTMADFWQMIWESESDVIAMMTKEVELGKVK
CHRYWPEPPHDSIDLTNFHLRLDSHQILEYFIVRIIEMINKQTEEKRIIRHLQFTTWPDH
NTPKLAEQLVKFICYMRKAHRTGPIVAHCSTGIGRSGVLLCAEILLSYIEKDLCFNIKHI
VRDLREQRFGMIQTKDQYLFCYEFVLEVLQKLQA
Download sequence
Identical sequences U3I0W2
ENSAPLP00000000882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]