SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000000884 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000000884
Domain Number 1 Region: 7-350
Classification Level Classification E-value
Superfamily Cullin repeat-like 2.88e-113
Family Cullin repeat 0.0000000000141
Further Details:      
 
Domain Number 2 Region: 349-620
Classification Level Classification E-value
Superfamily Cullin homology domain 1.06e-101
Family Cullin homology domain 0.000000000208
Further Details:      
 
Domain Number 3 Region: 620-708
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.99e-28
Family SCF ubiquitin ligase complex WHB domain 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000000884   Gene: ENSAPLG00000001201   Transcript: ENSAPLT00000001455
Sequence length 708
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743304.1:561944:597885:-1 gene:ENSAPLG00000001201 transcript:ENSAPLT00000001455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERPKLPDNYTQDTWQKLHDAVIQSSVSIRYNLEELYQAVENLCSYKVSATLYKQLRQVCE
DHVKAQILQFREYSLDSLLFLKKINKCWQDHCRQMIMIRSIFLFLDRTYVLQNSMLPSIW
DMGLELFRNHVISDKQVQNKTIDGILLLIERERSGEAVDRSLLRSLLSMLSDLQVYKESF
EQRFLEETNCLYAAEGQRLMQEREVPEYLHHVNKRLEEEGDRVITYLDHSTQKPLIACVE
KQLLGEHLTAILQKGLDNLLDENRISDLTQTYQLFSRVKGGQQILLQHWSEYIKNFGTTI
VVNPEKDKDMVQELLDFKDKVDHIIEVCFQKNEKFINLMKESFETFINKRPNKPAELIAK
YVDSKLRAGNKEATDEELERILDKIMIIFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDA
EKSMLSKLKHECGAAFTSKLEGMFKDMELSKDVMVQFKQYMQNQSDPGNIDLTVNILTMG
YWPTYTPMEVHLNSEMIKLQEVFKTFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQV
SLFQTLVLLMFNEGDEFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKNPKGKDVEDG
DKFIFNGDFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLG
HNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA
Download sequence
Identical sequences U3I0W4
ENSAPLP00000000884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]