SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001474 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001474
Domain Number 1 Region: 123-200
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.94e-35
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 2 Region: 200-276
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.22e-35
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 3 Region: 48-124
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.26e-35
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 4 Region: 2-48
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.33e-20
Family Ubiquitin-related 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001474   Gene: ENSAPLG00000002052   Transcript: ENSAPLT00000002048
Sequence length 277
Comment pep:novel scaffold:BGI_duck_1.0:KB742840.1:773672:774505:1 gene:ENSAPLG00000002052 transcript:ENSAPLT00000002048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGN
Download sequence
Identical sequences U3I2K4
ENSAPLP00000001474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]