SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002078 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002078
Domain Number 1 Region: 4-122
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.91e-35
Family Single strand DNA-binding domain, SSB 0.00000243
Further Details:      
 
Domain Number 2 Region: 153-220
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.86e-20
Family C-terminal domain of RPA32 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002078   Gene: ENSAPLG00000002616   Transcript: ENSAPLT00000002663
Sequence length 221
Comment pep:novel scaffold:BGI_duck_1.0:KB743739.1:521654:525734:-1 gene:ENSAPLG00000002616 transcript:ENSAPLT00000002663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVAPLLAAEQVEETFRIRDVEISQVTIMGIIRHAEKAPTNILYKVDDMTAAPMDVRQWVD
TDEAGGENIVVPPGTYVKVAGHLRSFQNKKSLVAFKIMPLENMNEFTTHILEIVNAHMIL
RKNLTAASRVPQSFTSAGIGDMGGYGGGGSLPVNGLTAHQSQVLNLIKNCPVPEGMSLQE
LKLQLPNVSMSTIKQAVEFLSSEGHIYSTVDDDHYKSTDAE
Download sequence
Identical sequences U3I4A7
ENSAPLP00000002078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]