SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002754 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002754
Domain Number 1 Region: 36-150,414-532
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 6.54e-82
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.00032
Further Details:      
 
Domain Number 2 Region: 215-387
Classification Level Classification E-value
Superfamily GroEL apical domain-like 7.95e-46
Family Group II chaperonin (CCT, TRIC), apical domain 0.00041
Further Details:      
 
Domain Number 3 Region: 150-219,378-413
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 7.32e-29
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002754   Gene: ENSAPLG00000003237   Transcript: ENSAPLT00000003347
Sequence length 534
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742875.1:589648:597114:1 gene:ENSAPLG00000003237 transcript:ENSAPLT00000003347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVPSPLPPEYAECGRGKRRVLSPGKXLSLSLSPLSAAVADAIRTSLGPKGMDKMIQDAK
GDVTITNDGATILKQMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACSRLLQ
KGIHPTIISESFQKALEKGIEVLTNMAQPVELSDRETLLNSATTSLNSKVVCQYSSLLSP
MSVDAVMKVIDPSTASSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVANTGVTRVEKAK
IGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKAGCNVLLIQKSIL
RDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTPDMLGSAELAEEV
NLNGSGKLIKITGCTNPGKTVTIVVRGSNKLVLEEAERSIHDALCVIRCLVKKRALIAGG
GAPEIELALRLNEYARTLRGMDSYCVRAYGDALEVIPSTLAENAGLNPISTVTELRNRHA
QGEKTAGINVRKGGISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVNTR
Download sequence
Identical sequences U3I683
ENSAPLP00000002754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]