SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002778 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002778
Domain Number 1 Region: 27-307
Classification Level Classification E-value
Superfamily Nudix 1.35e-55
Family MutT-like 0.000000000507
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002778   Gene: ENSAPLG00000003308   Transcript: ENSAPLT00000003371
Sequence length 314
Comment pep:novel scaffold:BGI_duck_1.0:KB742619.1:3677777:3683823:-1 gene:ENSAPLG00000003308 transcript:ENSAPLT00000003371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCSNLSAALWSHLHPANMLSSCQVARWHHSKALTSPYPGSRVERSRVPEDKVGWLTQWED
YNPVEYTAAAVLAGPKWADPQLSDKNFSPKFNERDGEVERTSRNGLYVVENGRPRNPAGR
TGLTGRGLLGRWGPNHAADPVVTRWKRDGSGNKIAHPVTGKNILQFVAIKRRDCGEWAIP
GGMVDPGEKISATLKREFGEEALNSLQKSPEEKASLEKQLQRLFSQEHFVVYKGYVDDPR
NTDNAWMETEAVNYHDETGETMDNLPLEAGDDAGMVKWVDISEKLKLYANHSYFIKLVTE
KRGAHWGEDPGPEC
Download sequence
Identical sequences R0LKZ6
ENSAPLP00000002778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]