SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003421 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003421
Domain Number 1 Region: 3-347
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.1e-83
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000132
Further Details:      
 
Domain Number 2 Region: 380-469
Classification Level Classification E-value
Superfamily DUSP-like 0.0000000000000602
Family DUSP, domain in ubiquitin-specific proteases 0.008
Further Details:      
 
Domain Number 3 Region: 866-921
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000612
Family Ubiquitin-related 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000003421
Domain Number - Region: 654-706
Classification Level Classification E-value
Superfamily DUSP-like 0.000536
Family DUSP, domain in ubiquitin-specific proteases 0.012
Further Details:      
 
Domain Number - Region: 563-601
Classification Level Classification E-value
Superfamily DUSP-like 0.00824
Family DUSP, domain in ubiquitin-specific proteases 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003421   Gene: ENSAPLG00000003841   Transcript: ENSAPLT00000004022
Sequence length 954
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744266.1:8936:38752:1 gene:ENSAPLG00000003841 transcript:ENSAPLT00000004022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NAFVGLTNLGATCYVNTFLQMWFLNLELRQALYLCPSTCSEHTAGEGVPKDKDYEPQTIC
EHLQYLFALLQNSKRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDV
RNIVQKQFCGEYAYVTVCNQCGRESKLVSKFYELELNIQGHKQLTDCITEFLKEEKLEGD
NRYFCETCQSKQNATRKIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNTYIGFSELLDMEP
FMEQKSGVYVYELSAVLIHRGVSAYSGHYIAHVKDPQTGEWYKFNDEDIEKMEGKKLQLG
IEEDLAEPSKSQTRKPKCGKGTHCSRNAYMLVYRLQTREKSLTVEVPAFLQELVERDNCK
FEEWCNEMAEMRKQSVARGKIKHEEVKELYQRLPAEAGSPYDFISLEWLQKWLDESTPPK
PIDNTACLCSHGKLHPDKICIMKRISEYVADFFYRRYGGGPRLNVKALCKDCVVERCRIL
RLKNQLNEDYKTVTNLLKITVKGNDGFWVGKASLRSWRQLALEQLNEQDEDAEHSNGKMN
GNAQNKDELSEEKREEEEELNFNEDIVCPHGDLCISENERRVVSKEAWKKLKQYFPKAPE
FPNNKECCSQCKILEREGEENEALHKMMASEQKTSLQNLFHDKCRPCLGSWPQETDELYI
VSQFFVEEWRKFVSLSRRPTRCSPVSSVGNSALLCPHGGLMFTYASMTKEDSKLIALIWP
SEWERIQKLFVVDHVIKITRTEAAGADPESALYTSEPKLCPECREGLLCQQQRDLREYTQ
ATIYIHKVVDNKKVMKDAAPELNVSSSEAEEEREEHKPEGEQDPDFNQTNGGAKRQKISH
QNYITYQKQGIRRSTRHRKVRGEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKI
LSDDTATLGSLGVIPESVILLKADEPLADYAAMDDVMQVCMPEEGFKGTGLLGH
Download sequence
Identical sequences U3I850
ENSAPLP00000003421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]