SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003545 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003545
Domain Number 1 Region: 11-153
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.35e-36
Family G proteins 0.0000571
Further Details:      
 
Domain Number 2 Region: 153-192
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000575
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003545   Gene: ENSAPLG00000004049   Transcript: ENSAPLT00000004146
Sequence length 232
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744413.1:51286:65223:-1 gene:ENSAPLG00000004049 transcript:ENSAPLT00000004146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTAASPELFLLGIDYKTTTILLDGRRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDI
TNRWSFDGIDRWIKEIDEHAPGVPRILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVS
PLCNFNVIESFTELSRIVLMRHGMEKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPV
TIKSHLKSFSMANGMNAVMMHGRSYSLVKRSKSIRPPQSPPQNCSRNNCKIS
Download sequence
Identical sequences U3I8H4
ENSAPLP00000003545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]