SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004311 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004311
Domain Number 1 Region: 65-330,404-432
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.44e-87
Family Creatinase/aminopeptidase 0.0000000000558
Further Details:      
 
Domain Number 2 Region: 330-403
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.25e-26
Family Methionine aminopeptidase, insert domain 0.0000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004311   Gene: ENSAPLG00000004742   Transcript: ENSAPLT00000004925
Sequence length 433
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743162.1:564790:582459:-1 gene:ENSAPLG00000004742 transcript:ENSAPLT00000004925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISQTGQETDKEVEGALDDVAKQLDKQTLEDKDKDDDDEVDGEGEGDGAAVGIKHKSRSSN
SRTKVQTDPPSIPICELFPSNIYPKGEECEYPPTQDGRTAAWRITSEEKKALDQASEEIW
NDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKENGLNAGLAFPTGCSLN
NCAAHYTPNAGDPTVLQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDRLLQAVKDATNT
GIKCAGIDVRLCDVGEAIQEVMESYEVEIDGKTYQEVKPIRNLNGHSIGPYRIHAGKTVP
IVKGGEATRMEEGEVYAIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIRLPRAKHLLNV
INENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLR
PTCKEVVSRGDDY
Download sequence
Identical sequences U3IAN9
ENSAPLP00000004311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]