SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004358 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004358
Domain Number 1 Region: 208-401
Classification Level Classification E-value
Superfamily GroEL apical domain-like 7.59e-74
Family GroEL-like chaperone, apical domain 0.00000473
Further Details:      
 
Domain Number 2 Region: 31-158,431-546
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 4.41e-73
Family GroEL chaperone, ATPase domain 0.0000986
Further Details:      
 
Domain Number 3 Region: 161-228
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 7.78e-27
Family GroEL-like chaperone, intermediate domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004358   Gene: ENSAPLG00000004780   Transcript: ENSAPLT00000004974
Sequence length 573
Comment pep:novel scaffold:BGI_duck_1.0:KB743301.1:1163507:1173631:-1 gene:ENSAPLG00000004780 transcript:ENSAPLT00000004974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLPAVLRQMRPVSRALAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGR
TVIIEQSWGSPKVTKDGVTVAKAIDLKDKYKNIGARLVQDVANNTNEEAGDGTTTATVLA
RAIAKEGFEKISKGANPVEIRRGVMLAVDAIIAELKKLSKPVTTPEEIAQVATISANGDQ
EIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTAKGQKCEFQ
DAYVLISEKKISSVQSIVPALEIANSHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAV
KAPGFGDNRKNQLKDMAIATGGAVFGEEGLNLNVEDIQPHDFGKVGEVIVTKDDTMLLKG
KGEKAQIEKRIQEIIEQLEVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDR
VTDALNATRAAVEEGIVPGGGCALLRCIPALDALTPANEDQKIGIEIIKRTLKIPAMTIA
KNAGVEGSLIVEKILQSPSEVGYDAMLGDFVNMVEKGIIDPTKVVRTALMDAAGVASLLS
TAEAVVTEVPKEEKEPAMGGMGGMGGGMGGGMF
Download sequence
Identical sequences R0L1Y3
ENSAPLP00000004358 XP_005021933.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]