SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004984 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004984
Domain Number 1 Region: 1-70
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.27e-18
Family Pointed domain 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000004984
Domain Number - Region: 102-130
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000122
Family ets domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004984   Gene: ENSAPLG00000005437   Transcript: ENSAPLT00000005608
Sequence length 131
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742410.1:95:958:-1 gene:ENSAPLG00000005437 transcript:ENSAPLT00000005608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPADWSPSNVQKWILWTEHQXXXXXXXXXXXXELSGKDLCAMSEEQFCQRSPVCGDVLHA
HLDIWKSAAWMKEKAAPGDVRYCGGDTSWADSEVDSSCAGQPIHLWQFLKELLLKPHNYG
RFIRWLNKEKG
Download sequence
Identical sequences U3ICL2
ENSAPLP00000004984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]