SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005497 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005497
Domain Number 1 Region: 44-117
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.52e-23
Family P4 origin-binding domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005497   Gene: ENSAPLG00000005911   Transcript: ENSAPLT00000006128
Sequence length 1381
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742572.1:379171:397916:-1 gene:ENSAPLG00000005911 transcript:ENSAPLT00000006128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEVEKFTDLEKLYLYLQLPSGPNNGDKSDQISMSSSHAQQMHAFSWIRNTLEEHPETSLP
KQEVYDEYKSYCDNLGYHPLSAADFGKIMKNVFPNMKARRLGTRGKSKYCYSGLRKKAFV
HMPTLPNLDFHKTGDGLDGTEPSGQLQSADEEVVSAACRLVCEWAQKVLSQPFDTVLELA
RFLVKSHYIGTKSMAALTVMAGAPAGIKGIPQPSAFMPTAESNSFQPQVKTLSSPVDAKQ
QLQRKIQKKQQEQKLQSPLPGESPAKKTEGTATNGVTSISNGSPAILSPQPIGIVVAAVP
SPIPVPRTRQLVTSPSPMGSSDSKVLPLNVQVVTQHMQSVKQSPKTPQNVPASPVGDRSA
RHRYPQILPKPANTSALTIRSPTTVLFTSSPIKTVVPAPHVNSLNVVKMTAISLAPSSGS
VPVKQTPSVNSTAGAVEEGRAAPQMKNGSLVSLQSPGSKPSTVVAASAVEIKMEPEALLD
ENPVQGQESSEVSKSIKAAPGLPPAQQINFEVTTLKVSADGVVEAKTVKGCDQGAEEAGT
KYKTQSNEMTPVSSAGNNQSTLKLSVASTSIGSPPTGESTIKDKVCTKSPRKRQPSTLQD
SQVPPVKKPLVGQLSAGNAVEGQKANSVKKAPKVVSLASGDNTATLAQVPSKVPVDVPVP
STAPANVATDCSLSTNLNTSDPTLGQQLASASSPDIKVKLEGNMFIIENDSKSDGSFNPN
AWHHITKTSDFASVNCDQQQDISVMTIAGHSGSSDLQESAWEPVHCEGMQQDVYNQQLQS
QLQDSSLGQIQAQSSNQLPLQSELKEFEHTVPQSNENFFSFDDDLTQDSIVEELVLMEEQ
MSMNNPHPYGGCLGMALQSQTAAQGAPVSSHPSSTHFYHSIHNNSTPIPEMISGSQNVSR
ESPCSRLAQTTPVDSALGSSRHTPIGTPHSNCSSSVPPSPVECRNPFAFTPISSSMAYHD
ASIVSSSPVKPMQRPMATHPDKTKLEWMNNGYGGVTNSSVANHGILTSYQELVEDRFRKP
HAFAVPGQSYQSQPRHHDTHFGRVTPVSPVQHQAAPVSNTTKQEGFAVPAPLDNKGASST
LNNSLRCRSVSPAVHRQRNLSGSTVYPVSNIPRSNVTPFGSPVTPEVHNVFTNIHADTSA
NNIAQRSQSVPLTVMMQTAFPSLQKQTNTKKITNVLLSKLDSDSDDAVRGLGMNNMPSNY
TARMNLTQILETSTAFPSANPQNMINSSTSVYEFQTPNYLTKNSSTDQISFSSGDNQAQS
DIGEQQLDFSSTVKDLLGEDSLPTNQQLVNQVASDLNVTSVFSSDIRLSSELSGSINDLN
TLDTNLLFDPGRQQGQDDDATLEELKNDPLFQQICNESINSMTSGFEWMESKDHPAVEML
G
Download sequence
Identical sequences U3IE25
ENSAPLP00000005497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]