SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005793 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005793
Domain Number 1 Region: 12-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.76e-40
Family Forkhead DNA-binding domain 0.0000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005793   Gene: ENSAPLG00000006208   Transcript: ENSAPLT00000006426
Sequence length 267
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744306.1:2155588:2157134:-1 gene:ENSAPLG00000006208 transcript:ENSAPLT00000006426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNS
LRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVVKSDHLAPS
KPADAAQYLQQQAKLRLSALAATGTHLPQMSTYNLGVSQPSSFKHPFAIENIIAREYKMP
GGLAFSTMQPAAYPLPNQLTTVGSSIGTGWPHMYGSGMIDTATPISMASAQRTRSAAGVG
QAPSVHSIASKPTIPIKINLSQAHHPA
Download sequence
Identical sequences U3IEX1
ENSAPLP00000005793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]