SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005841 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005841
Domain Number 1 Region: 44-199
Classification Level Classification E-value
Superfamily ARM repeat 0.00000241
Family Clathrin adaptor core protein 0.053
Further Details:      
 
Domain Number 2 Region: 277-339
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000653
Family PCI domain (PINT motif) 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005841   Gene: ENSAPLG00000006196   Transcript: ENSAPLT00000006474
Sequence length 375
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743317.1:2143930:2159119:1 gene:ENSAPLG00000006196 transcript:ENSAPLT00000006474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LELPCFSDWETDSRQLRLRAFLMKGKGAEISEENNEGGLHVDLAQIIEACDVCLKEDDKD
VESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPV
RYTVYCSLLKVASSCGAIQYIPTELDQVRKWISDWNLSTEKKHTLLRLLYDVLVDCKKSD
TAAKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNTFLFDHLLALKPVKFLEGELIHD
LLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQ
ELQIGADDVEAFVIDAVKTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNTWKQ
NLNQVKNSLLSLSDT
Download sequence
Identical sequences U3IF19
ENSAPLP00000005841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]