SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005877 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005877
Domain Number 1 Region: 81-223
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.91e-39
Family Regulator of G-protein signaling, RGS 0.000000195
Further Details:      
 
Domain Number 2 Region: 765-846
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.82e-27
Family DIX domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005877   Gene: ENSAPLG00000006260   Transcript: ENSAPLT00000006512
Sequence length 846
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744458.1:520869:596424:1 gene:ENSAPLG00000006260 transcript:ENSAPLT00000006512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANARKMNIQGKGFPLDLGGSFTEDAPRPPVPGEEGELVSTDPRPVSHGFYSSKSDVVRNE
TSTATPRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLL
DFWFACSGFRKLEPCVSNEEKRLKLAKAIYKKYILDNNGIVSRQIKPATKSFIKDCVVKL
QIDPDMFDQAQTEIQCMIEDNTYPLFLKSDIYLEYTRTGGESPKIYSDPSSGSGTGKGLP
GYLPTLNEDEEWKCDQDAEPEASRDSAPSSRLTQKLLLETATQRASSTRRYSEGREFRHG
SWREPVNPYYVNTGYALAPATSANDSEQQSMSSDADTMSLTDSSVDGIPPYRLRKQHRRE
MQESAKANGRVPLPHIPRTYRMPKDIHVEPEKFAAELINRLEEVQKEREAEEKLEERLKR
VRAEEEGEEADISSGPSVISHKMPSAQTFHHFAPRYSEMGCAGMQMRDAHEENPESILDE
HVQRVMKTPGCQSPGPGRHSPKPRSPESGHLGKLSGTLGTIPPGHGKHTTKSGMKLDAAN
LYHHKHVYHHIHHHSVMKPKEQIEAEATQRVQNSFAWNVDSHNYATKSRNYTENLGMASV
PMDSLGYSGKASLLSKRNVKKTDSGKSDGANYEMPGSPEDVERNQKILQWIIEGEKEISR
HKKTNHGSSGAKKQLSHDMVRPLSIERPVAVHPWVSAQLRNVVQPSHPFIQDPTMPPNPA
PNPLTQLEEARRRLEEEEKRAGKLPLKQRLKPQKRPGSGASQPCENIVVAYYFCGEPIPY
RTLVKGRVVTLGQFKELLTKKGNYRYYFKKVSDEFDCGVVFEEVREDDTILPIFEEKIIG
KVEKID
Download sequence
Identical sequences U3IF55
ENSAPLP00000005877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]