SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006298 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAPLP00000006298
Domain Number - Region: 422-496
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0734
Family PCI domain (PINT motif) 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006298   Gene: ENSAPLG00000006637   Transcript: ENSAPLT00000006941
Sequence length 1347
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743226.1:601689:632761:-1 gene:ENSAPLG00000006637 transcript:ENSAPLT00000006941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPKYFVGAEHAVILLSEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLGQIQRHHNQSTAINLNNPDSQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFALSKKPPKPQLMANYYHKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQEEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRGSLINDMVRFNVVQYVVPEVKELYNWLEVDFHPLKLCSRVSKVLNWVKDQAEK
EPELQLYVPHLQNNTILRLLQQVAQIYQSIEFSRLATLVPFVDAFQLERCIVDAARHCDL
QVRLDHTTRTLSFGSDLNYCTREDAPLGPQLQSMPSEQIRNQLTAMSSALAKALAVIKPP
HLLQEKEEQHQLAVTAFLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKTAYEEQRVR
DMELWEQQEEERITTLQLEREKALEHKNRLSRMLEDRDLFEARLKASRRTVYEDKLKQFQ
ERLAEERRNRLEERKKQRKEERRITYYREKEEEEQRLREEQLLKEREEKERIEREKREQE
QREYQERVKKLEELEKKKRQREMEIEERERRREEERRGLDDPFSRKESRWGDRGESESSW
RRGGETESEWRRAPVERDWRRGEARDDDRPFRRGDDLPRRGDDLPRRGDDLPRRGAAEEK
DRPSVGGAEDRPPRREGDEERPPRREGDEDRPPRRGLDEDRPPRRALDDDRXRRAADDDR
GPRRGMDDDRPPRRALDDDRPPRRGLDDDRPPRRALDDDRPPRRGLDDDRGRTQPPRRGL
DDDRGSWRAADDDRGPRRGLDDDRGPRRGLDDDRGPWRSTDDDRLSRRDDDRGPWRSSED
SRPGPWRPFGKPGGWREREKAREDSWGPPRDSRPPGDREWDRDKDRDENEKDREFDRERD
FDRDDRFRRPRDDAGWRRGPAEENSSWRDSSRREEWDRGGRDMRDRRADDRDLPPRRGPP
LRSDREEPSSWRRADDRREERGEEREPVRRSAPAPAAAPAAASPAASKDRERDGEKEKGS
WKTEKEREPVRRTKNETDEEGWTTVRR
Download sequence
Identical sequences U3IGC6
ENSAPLP00000006298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]