SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006947 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006947
Domain Number 1 Region: 7-146
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.4e-38
Family G proteins 0.0000383
Further Details:      
 
Domain Number 2 Region: 148-186
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000209
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006947   Gene: ENSAPLG00000007309   Transcript: ENSAPLT00000007598
Sequence length 237
Comment pep:novel scaffold:BGI_duck_1.0:KB742959.1:3305:7927:1 gene:ENSAPLG00000007309 transcript:ENSAPLT00000007598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVFPSGIDYKTTTILLDGRRIKLQLWDTSGQGRFCTIFRSYSRGAQGVILVYDITNRWS
FDGIDRWIKEIDEHAPGVPKILVGNRLHLAFKRQVSTEQAQAYAERLGMTFFEVSPLCNF
NITESFTELARIVLMRHGMDRLWRPNKVLSLQDLCCRAIVSCTPVHLVDKLPLPVALRSH
LKSFSMANGLNARMMHGRSYSLTSSNINKRNSLKKAKIIRPPQSPPKNCTRNSCKIS
Download sequence
Identical sequences U3II75
ENSAPLP00000006947 XP_005017973.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]