SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007024 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007024
Domain Number 1 Region: 4-352
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.7e-66
Family ADP-ribosylglycohydrolase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007024   Gene: ENSAPLG00000007399   Transcript: ENSAPLT00000007675
Sequence length 353
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742931.1:1539890:1547543:-1 gene:ENSAPLG00000007399 transcript:ENSAPLT00000007675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FCPKEMENYVASMVLSALGDTLGYYNGKWEFLQHGPTIHKELAEMGGLSNISIKGWKVSD
DTVMHLATAEALVAAGKNPRLEHLYSLIANNYKECMNDMEGRAPGAMCQKNALNLKPEKP
DGWRIPFSPKGGGCGAAMRSMCIGLRFHRADELDTLVQVSIESGRMTHHHPTGYLGSLAS
ALFTAFAVNNVPPPAWGKKLLEVLPRAKAYVRDAGFFVEENMGQWYYFEEQWKKYLAKRG
ILDGVSLPTFPSKYGVEERDSFYTSLSYDGWAGSSGHDAPMIAYDALLGAGDSWTELAHR
AFFHAGDSDSTAAIAACWWGAMHGFRGVAASLYAPLEYRERLEKVGKDLYRLT
Download sequence
Identical sequences U3IIF2
ENSAPLP00000007024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]