SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008480 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008480
Domain Number 1 Region: 685-831
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.49e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1015-1115
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.75e-30
Family Ras-binding domain, RBD 0.00086
Further Details:      
 
Domain Number 3 Region: 220-368
Classification Level Classification E-value
Superfamily PH domain-like 2.03e-22
Family Phosphotyrosine-binding domain (PTB) 0.012
Further Details:      
 
Domain Number 4 Region: 8-99
Classification Level Classification E-value
Superfamily PDZ domain-like 2.4e-20
Family PDZ domain 0.011
Further Details:      
 
Domain Number 5 Region: 960-1029
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000635
Family Ras-binding domain, RBD 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008480   Gene: ENSAPLG00000008768   Transcript: ENSAPLT00000009160
Sequence length 1367
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742833.1:3561913:3629502:1 gene:ENSAPLG00000008768 transcript:ENSAPLT00000009160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRPGETVKRRLNMHAPPRIRSVEVARGRAGYGFTLSGQAPCVLSCVMKGSPADYVGLKA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGISHIDSCSSDEEVGFYDGKGWL
KPKPDSKALGINRAEKVVEEMQSGGIFNMIFENPNLCAGNSDNTTPKQRSFSDSAAIKYE
TGNESVSNPNLLSKEEMSKVPNDDSVFRIGLESAEDFGLDASILNVAMIVGYLGSIELPS
TTSNLENESLQAIRGCMRRLRAEQKIHSLVMMKIMHDCIQLCSDKSGVVAEYPAEKLAFS
AVCPDDRRFFGLVTMQTNDDASLAQEDEGVLRTSCHVFMVDPDLFHHKIHQGIARRFGLE
CTADPDTNGCLEFPTSSLPVLQFISVLYRDMGELIEGMRARAFLDGDADPHQNNSTSSNS
DSGIGNFNQEEKNNRVLVVDLGSNPSKHIPNSIWENPVGRGQNQSASHWNGFCHEQEGNI
PLEVIQNDKSQNLNKHLCPSARIEVPLVSSRNSVPPSKKSAAGMGNQRWLPVHVLQEWQH
GNASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVDGSFGQPQLKSHKNEWSKKMFC
MQNKFGPPHSVRKSKEDKKGSKFGHSVGLNQAPPQRSSARRSFGRSKRFSITRSLDDLES
ATVSDGAELNSTDLKDCISENSLSSNASLPSVQSCRRLRDRRVASWAVSFERLLQDPLGV
KYFSEFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFTKFLCSKATTPVNIDS
QAQLADDILNSPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRTLPDPQR
VPSSPTSKHSISSEKSNISTPKKLSGKSKSGRSLNEESGEEDTEKKKRGTFFSWSRSKSL
GKSQKRKENGDYQHETDSIQSNGLSYRRESQGSMSSTASLDLSETSRLPAFVPDKEKSPK
YCCVNLPDGSSSKMAVKSGFSIKEVLSGLCEKHGINIAAVDLFLVGGDKPLVLHQDSSIL
ESRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLNLNELVARLNGEQ
EPLDLGVPISNLDGQRVVLDEKEPTKSRVFTDKQKGASVKQSVTVTTSRNQVSTTGEGRT
LGKSNSIKMKGENGKNAREVRLSKREDSIAKIGKKKCQKINLDEAEEFFELISKAQSNRA
DDQRGLLRKEDLILPDFLRLPPTGPEPSSSTPAGPKGLNKRVSKSDGKDGCTSPNGKQES
IQNYNENSVKKMGYSENKHKSALTALHSQKTFSVPFNTTLSPIPHAHENNATIWKRQSRE
LQAEGIQMVDDENVADLTLVAEGDISSPNSTLLPPPPPTPPSDISKL
Download sequence
Identical sequences U3IMK7
ENSAPLP00000008480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]