SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008610 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008610
Domain Number 1 Region: 2-150,194-567
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 8.11e-81
Family Acetyl-CoA synthetase-like 0.0000135
Further Details:      
 
Domain Number 2 Region: 761-1101
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 9.42e-44
Family Quinoprotein alcohol dehydrogenase-like 0.0087
Further Details:      
 
Domain Number 3 Region: 557-636
Classification Level Classification E-value
Superfamily ACP-like 0.0000916
Family Peptidyl carrier domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008610   Gene: ENSAPLG00000008927   Transcript: ENSAPLT00000009292
Sequence length 1107
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742619.1:1171279:1189171:-1 gene:ENSAPLG00000008927 transcript:ENSAPLT00000009292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQEMVNQAASLYSDRKAVWFDQCNDEPPIFYTYATVVKLATELTAFLQKHCSHQGKCE
IGLYCYPGINLPSWILGILQVPAAYSPIDPDAPPVLSTYFIRKSNLRYILVENDKVKKFQ
MSHAGWFSCNSSAVEHMGLTLFQMSWSNTDVNSQADNVNSKYEPLKGNTVCPEQLKVKTS
EGGGYMDVGQNCSLAYVLHTSGTTGTPKIVRVPHKCIVPNIQHLKSIFEITPDDVLFLAS
PLTFDPSVVELFITLTSGASILVVPNTVKMMPLELSAALFHHHHVTVLQATPTLLRRFGA
HIIKSTVLAADTSLRVLALGGEAFPILSLLKTWKHQENRTSIFNLYGITEVSSWATCYKI
PEEVFSADFRTNFSVPLGSPLLGTTVEVRDDNGSAVLEGEGQVFIGGEERICFLDDEITV
PPGTMRETGDFVRVQNAQMVFLGRKDNQIKRHGKRFNIECLQQQAAEDLCQVEACAVTWY
QQEKLILFVVPSGDLEERETLQELQKHLPAHAIPDELVQIKSLPLTSHGKVDISELNKIY
HNHLTSRRRDSKLNGAEELWERLQYLWKSVLGFLGDSSGISRDAVFLHSGGDSLKALQFY
DEIEVLVGRAVPGLLEVILSRTIEQVYTHILKTVFPDEDQLINNDNVLKRKLSENNGEEI
HGKYGKLKSERYLKVVPGLISFIALSRGNHFLSMHFTKSLMQPSNTAQHLATPSIMNSHV
QGHDMEKNGILTINSKANKTDCSSVQQLHAECSHITTAELTLCTRWKSNTRKCVDASPLV
IIPFKDEVSASVYVGSHSHTMQAIDLDLGEIKWEKTLGDRIESSACISKCGNFIIVGCYD
GLVYVLQSSDGETHWAFVTEDTVKSSAVVDPSSGLVYIGSHDQHLYALDIYKKVCIWKLH
CEGGAVFSSPCLSSSPHHIYVATLGGLLLAVNPVTGNKIWKSFLGKPLFSSPHCNEKCVC
VGCVDGNLYCYTHSGEKVWQFPTSGPVFSSPCISTLTKQEIFFGSHDRFIYCCNTEGNLL
WKFEATSSVYGTPFVFQSDDLKNKILLAAVSTDGTVWILNAKSGTAEGVAKLPGEVFSSP
VVWGTKLVVGCRNDYVYCLDLCITGEK
Download sequence
Identical sequences U3IMY7
ENSAPLP00000008610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]