SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009034 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009034
Domain Number 1 Region: 99-213
Classification Level Classification E-value
Superfamily ARID-like 6.93e-36
Family ARID domain 0.00000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009034   Gene: ENSAPLG00000009328   Transcript: ENSAPLT00000009720
Sequence length 434
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744986.1:33867:60415:-1 gene:ENSAPLG00000009328 transcript:ENSAPLT00000009720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGADVTGKEPCSALKYFHAPKAAQHNQRVASTSNSPPAAGHPRGQQGREEQGKDTAKQPY
SGSPAARWRLDEQLKQNGSVTWSDEGDGCRGREISRDFAKLYELDSDPERKEFLDDLFIF
MQKRGTPINRIPIMAKQILDLYMLYKLVTEKGGLVEIINKKIWREITKGLNLPTSITSAA
FTLRTQYMKYLYAYECEKKSLSSPAELQAAIDGNRREGRRPSYSSSLFSYSTATGPPSLL
SPPKIRFPIIGVAPGSGTSNPRVSPAAAVRKGDGVPLTVSMPNRIAVPVTLASQQATVAA
RTATLLRERLESGEPPEKKVSRMTEEEQRLVQQALQRNLFSMARQIPMKIKINGKEDKPD
SAAAAALNLSPNGIGSINMSVEINGTIYAGVLFAQKPVVHLIAGSSTQSSSHCSASPTSS
RGTPGAEPSTSWSL
Download sequence
Identical sequences U3IP61
ENSAPLP00000009034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]