SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010867 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010867
Domain Number 1 Region: 72-209
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.02e-38
Family Regulator of G-protein signaling, RGS 0.00000443
Further Details:      
 
Domain Number 2 Region: 739-819
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-27
Family DIX domain 0.0000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010867   Gene: ENSAPLG00000011112   Transcript: ENSAPLT00000011585
Sequence length 819
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742832.1:1001480:1024205:1 gene:ENSAPLG00000011112 transcript:ENSAPLT00000011585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAVVLAHLPDPSSSFREDAPRPPVPGEEGEAPCPQPPSSFLGKSQSFKAMPVPPAPRR
NENGLGEPEGSASPDSPLARWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGF
RQMDLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDSIKKQQIDSIMFDQAQTE
IQTVMEENAYQMFLTSDIYLEYVRSGGENPAYINSNGLGSLKVVCGYLPTLNEEEEWSCA
DFKNKILPSVVGLSSKTLRVTANVRAMETIESGYRSFKRNDPVNPYHVNSGYVFAPATSA
NDSEISSDALTDDSMSMTDSSVDGIPPYRIGSKKQLQREMHRSVKANGQVSLPHFPRTHR
LPKEMTPVEPAAFAAELISRLEKLKQEQETMDSLEERLQQIKEDEEKEGSELPASLQSSR
EVANPQHSQHPLSLLPSGSYEEDPQAILDEHLSRVKTPGCQSPGMGRHSPCARSPDRLPG
GKLQPGVASPAGKGFITKQTTKHVHHHYIHHHAVPKTKEQIEAEAAQRAQCCCPAGSDYY
CFSKCKGHLKGTDPPLPPLEPFGSSRTGTLTKRPGRGVESIALPAGDGGLPGPGGVQLPG
GEADRAQNVWQWMLESERQNKHKPHSTQSTKKAYSSDFAKGAPSEPRGVQPAHPFVQDPT
MPPLTPPNTLAQLEEACRRLAEVSKPQKQRCSTSNQQRDRNHSAAVQGGNTPFCNASLTT
EDHKEPKKLPVVHTSQSSELVVTYFFCGEEIPYRRMLKAQSLTLGHFKEQLSKKGNYRYY
FKKASDEFDCGAVFEEIWEDETILPMYEGRILGKVERID
Download sequence
Identical sequences U3IUE4
ENSAPLP00000010867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]