SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011003 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011003
Domain Number 1 Region: 295-460,561-814
Classification Level Classification E-value
Superfamily Ras GEF 2.22e-105
Family Ras GEF 0.00012
Further Details:      
 
Domain Number 2 Region: 468-570
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.32e-31
Family Ras-binding domain, RBD 0.0000214
Further Details:      
 
Domain Number 3 Region: 29-147
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.99e-26
Family DEP domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011003   Gene: ENSAPLG00000011214   Transcript: ENSAPLT00000011723
Sequence length 814
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743177.1:810654:939006:-1 gene:ENSAPLG00000011214 transcript:ENSAPLT00000011723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTFLQTLSRRISNPYLETPSNKIYGESSSCAGRALRNIFTLQASDLIKDRVYLTGICRRS
CVGSELVDWLLEHCPFVKCRSTAVGVWQLLLDMGIILSVDRQLYFQDAHAFYQFSADECT
YLFCEFEKEECWKNGVKLLLQLLPLAPPRIDICSMPDQKIEDTTETNAEILARLTSAVQR
ELAAVIALKARKSAIHQNEENNSQEKRGLEELKDTSDAQAGVLCKLQERDDIGRIELVQK
LARENCQFLQADRKQPEKTEQNEEEQVTQLQVAQEVKKEIQGKNIAKCKQAIISKGCQRR
DNRYVVVAGTPEKILEHLLSDLHLEAAQDKDTETLLDDFLLTYTVFMTTDDLCQALLSTY
CAKNYQGKEDDSDVSCRKRKVLHLVSQWTSLYKDWLHEDEHLKQFLKTIYRNVLDDVYEY
PILEKELKEFQKILGMHRRHTVDEYSPHRKNKTFFHQFSLKESWLQHRGTMNEAEEIFCR
VYITEHSYVSVKAQVTASAQEILKIIAEKIQYPEEELALVTVTFSGEKHELQPNDLAISK
SFESSSRMFVYRKDLTDSLNPFAENEELQQRSVRILGINTWDLALELTNFDWSLFNAIHE
QELIYFTFSRQGSAENTENLSLLLQRCNEVQLWVATEILLCSQLCKRVQLVKKFIKIAAH
CKAQRNLNSFFAIVMGLNTASVSRLSQTWEKIPGKFKKLFTELESLTDPSLNHKAYRDAF
KKMKSPKIPFMPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADTVRSLRHCRNNQFGNEV
PSKEHHELKPYVHHLHVIDNQQALFELSHRIEPR
Download sequence
Identical sequences U3IUT0
ENSAPLP00000011003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]