SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011820 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011820
Domain Number 1 Region: 453-741
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.09e-79
Family Protein kinases, catalytic subunit 0.000000000158
Further Details:      
 
Domain Number 2 Region: 952-1089
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 2.22e-59
Family FAT domain of focal adhesion kinase 0.000000192
Further Details:      
 
Domain Number 3 Region: 132-253
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-40
Family Second domain of FERM 0.00000033
Further Details:      
 
Domain Number 4 Region: 31-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.65e-39
Family First domain of FERM 0.00000228
Further Details:      
 
Domain Number 5 Region: 254-362
Classification Level Classification E-value
Superfamily PH domain-like 6.64e-37
Family Third domain of FERM 0.00000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011820   Gene: ENSAPLG00000011901   Transcript: ENSAPLT00000012552
Sequence length 1096
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743275.1:138577:247930:-1 gene:ENSAPLG00000011901 transcript:ENSAPLT00000012552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAYLDPNLNHTPSSSAKTHLSTGMERSPGSMERVLKVFHYFETSSEPTTWASNIRHGD
ATDVRGIIQKIVDSQKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFEQAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSY
GEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFII
RPQKEGERALPSIPKLANNEKQGVRSHTVSVSGVNHCQHKVKKAKRFLPFVFCSHEPPPK
DEISGDETDDYAEIIDEEDTYTMPSKSYGIDEARDYEIQRERIELGRCIGEGQFGDVHQG
VYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPNIVKLIGVITENPVWIIM
ELCTLGEKKLRSFLQVRKYSLDLASLILYAYQLSMALAYLESKRFVHRDIAARNVLVSAT
DCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILM
HGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLS
TILEEEKLQQEERMRMESRRQVTVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMV
QPNHYQVSGYPGSHGIPAMAGSIYPGQASLLDQTDSWNHRPQEISVWQPNMEDSGTLDIR
GMGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGGLQGPAGN
QHIYQPVGKPADHTAPPKKPPRPGAPGHLGSLASLNSPVDSYNEGVKLQPQEISPPPTAN
LDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETLPVLP
ASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLD
VIDQARLKMISQSRPH
Download sequence
Identical sequences U3IX44
ENSAPLP00000011820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]