SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012385 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAPLP00000012385
Domain Number - Region: 9-52
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0102
Family SAM (sterile alpha motif) domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012385   Gene: ENSAPLG00000012579   Transcript: ENSAPLT00000013123
Sequence length 499
Comment pep:novel scaffold:BGI_duck_1.0:KB742542.1:776499:794692:1 gene:ENSAPLG00000012579 transcript:ENSAPLT00000013123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASALPRTLGELQLYRILQKANLLFYFDAFIQQGGDDVQQLCEAGEEEFLEIMALVGMAS
KPLHVRRLQKALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSPAWLGISCSSYERNSST
REPHLKIPKCAATTCVQSVGASKSDVVGSLSLQSGSEPRLWQGHHTTESEHSLSPADLGS
PASPKENSETLDAAAALSVAECVERMVPSLPKSDLSEVKELLKTNKKLAKMIGHIFEMSD
EDPHKEEEIRKYSAIYGRFDSKRKDGKHLTLHELTVNEAAAQLCVKDNALLTRRDELFAL
ARQISREVTYKYTYRTTKSKCGERDELSPKRIKIEDGYPDFQDSVQTLYQPDKMPLALAK
GKSEDSAALNSQSEKVMAKQMELLCSQAGLERRLSAGCYRQNSEEHSPNGMSLDNLDGQG
ERPLNLRMSNLPSRQLQHISLDGEQHVGKPLCSELIRLYPGGEAKSQSSEGLGILKDFPH
SAFNNIERKVIKTEPEDTR
Download sequence
Identical sequences R0M3N5
ENSAPLP00000012385 XP_005011475.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]