SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012433 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000012433
Domain Number 1 Region: 1146-1278,1342-1408
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.2e-33
Family Hemopexin-like domain 0.001
Further Details:      
 
Domain Number 2 Region: 67-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000209
Family Somatomedin B domain 0.001
Further Details:      
 
Domain Number 3 Region: 26-64
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000222
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012433   Gene: ENSAPLG00000012642   Transcript: ENSAPLT00000013172
Sequence length 1408
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744663.1:139722:157684:1 gene:ENSAPLG00000012642 transcript:ENSAPLT00000013172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRWNVLCVSLVILSLTLIQEVSSQDLWSCTGRCGEGYSREHGCHCDYNCQYYMECCADFK
KVCTVAVSCKGRCFEAFERGRECDCDADCERYGKCCPDYAKHCKEAHTEKTTPKTPPPNK
STSKRSSANEEKKPEEVTQPHEVIEGNQYSRSNETKLRNYSSYCKILSVSSLLREALHQY
IHQAMTVRKNLENRTKWKNITKVTLRDQKTKFTDMGSEKMVTSPPPTTKQPDTTPPIKAT
TVKPSTPKPSLTPTTSITTKPTTSKALETTPEDTEAPTTEEYPTITPKEEEITPEATEEP
PTDTDSPVSPEAEETTPEATESPTTPKAEETTPEATEAPTTPKAEETTPEATEAPTTPKA
EETTPEATEAPTTPKAEETTPEATEAPTTPKAEETTPEATEAPTTPKAEETTPEATEAPT
TPKAEETTPEATEAPTTPKAEETTPEATVAPTTPKAEETTPEATEAPTTPKAEETTPEAT
EAPTTPKAEETTPEATEAPTTPKAEETTPEATEAPTTPKAEETTPEATEAPTTPKAEETT
PEATEAPTTPKAEETTPEATEAPTTPKAEETTPEATEAPTTPKAEETTPEATEAPTTPKA
EETTPEATEAPTTPKAEETTPEATEAPTTPKAEETTPEATEAPTTPKAEETTPEATEAPT
TPKAEETTPEATEAPTTPKAEETTPEATEAPTTPKAEETTPEATEAPTTPKAEETTPEAT
EAPTTPKAEETTPEATEAPTTPKAEETTPEATEAPTTPKAEETTPEATEAPTTPKAEETT
PEATEAPTTPKAEETTPEATEAPTTPKAEETTPEATEAPTTPKAEETTPEATEAPTTPKA
EETTPEATEAPTTPKAEETTPEATEAPTTPKAEETTPEATVAPTTPEATDALTSPKAEEI
TPKAEETIPEAPEAPMTPKAEETTLKATDAPTTPKAEEMIPKVTKAPVTPKATEAPTTKA
DSSTTPQATEAPTTLKAAKKTPKATKAPKTEAESPTTPKAKETTLRATEAPTTKAGSPTI
PEVEFTTPALLNSKSDTTTSGEKSATTPVKNDKTTTKPVTTPVTKETTTRRETTTVKGTS
KPDIHFQEVTDTRDEPHPANPETMPVKEEPDINKPLIQTVDLPVLPGETQGKCIPNKSLG
KTDEKDLCSGKPADSMVALPNGTLAVFRGHYYWLLNGRSPPTTNPRRISEGWGIPSPIDT
VFSRCNCDGKTFFIKGNLYWRFTNGVMDKGYPKPLANGFAGLNGKMVAALPVARYNSRPE
SVYFIKRDGNMQQYVYRQEPAKKCQRKARITIRYPAFVPRLVIRRRFQRAVGLPTVIQTV
RINPYPSGILCLFAGVLRKEVKMTAYWRGLPKVIHSTISVPNYNKPDGYDYYAFSYNRYY
SLDVGKRIARPVTALTGKTVSKDWYNCP
Download sequence
Identical sequences U3IYV7
ENSAPLP00000012433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]