SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013087 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013087
Domain Number 1 Region: 69-160
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.16e-17
Family Ubiquitin-related 0.00011
Further Details:      
 
Domain Number 2 Region: 473-539
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000147
Family UBA domain 0.0013
Further Details:      
 
Domain Number 3 Region: 347-414
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000862
Family UBA domain 0.019
Further Details:      
 
Domain Number 4 Region: 432-470
Classification Level Classification E-value
Superfamily UBA-like 0.000000222
Family UBA domain 0.033
Further Details:      
 
Domain Number 5 Region: 234-367
Classification Level Classification E-value
Superfamily TPR-like 0.00000587
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013087   Gene: ENSAPLG00000013255   Transcript: ENSAPLT00000013835
Sequence length 611
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743973.1:656814:668752:1 gene:ENSAPLG00000013255 transcript:ENSAPLT00000013835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKKYLIAKLTSCLREDKIQLWKPPYTNENKEAGEEMKELAQKYSSKLNINENDTENML
EEIRCKAIERGTGNENFKVTGIARLDIYLPRRKSRKIPLETSLFITGKELRSQIAQEHAL
KENAIKIIINKKQLDLGRTLEDQGVTHNAKVMVLQLEQSDEETKRKVQEEELQRKKEKDI
SDQMQRTKKGLEILAERVSEEYLDPDTAPYLDIANQTGRSIEIPPQAKKALVLAMGYHEK
GRALMKKKEYEIALPYLLDADKHFCECSTELLNTVDNYAVLQLDIVWCYFRLEQLDCLDD
AEKKLTTAHRCFQRCYGENHERLIDIKGSYGREKVLFLRLYLLQGIGHYHSGREKEAAEY
IQKASHLYDELYIDPEKVYRLSLLGFSEQEARLALRACHGNVEHAANLITNRREEKAQIR
REERAKRRQRLEDINTLKSMGYSERAAQVALHHAQGNLDQAFKFILDNPELLLENDDDDD
SVAMDQFQVSQESIDQLMYMGFSHESAKQALKVFRGNIHLASQTLAHYGGVLPASLQLSS
EGSSPSEESASSKDSPTESAEGSSSSQTDEDMETDAVNEILEDIPEHEEDYLDLTLEEEE
QIIHEYLSYIQ
Download sequence
Identical sequences U3J0R0
ENSAPLP00000013087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]