SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013292 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013292
Domain Number 1 Region: 483-586
Classification Level Classification E-value
Superfamily TAFH domain-like 4.32e-36
Family TAFH domain-like 0.00000463
Further Details:      
 
Domain Number 2 Region: 763-810
Classification Level Classification E-value
Superfamily Histone-fold 4.19e-17
Family TBP-associated factors, TAFs 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013292   Gene: ENSAPLG00000013454   Transcript: ENSAPLT00000014040
Sequence length 976
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742479.1:259355:294611:1 gene:ENSAPLG00000013454 transcript:ENSAPLT00000014040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDGATTTSTSTTTAAAGGSEVTAAPGTLSQGKSVVISTMATAMSTRNGKIGTTTVQTLNG
SNVVMNSHHAGSAAFSGTPVTANPASAPAVAPLVNNGPGSVGKGNTVNAVLPSASNTVIQ
TSFLNTAVSSASSSSPTVISSQPPPSVGSGAPTVTLVRPPIHTAGPTVAAAGAATQNGSN
TVINSTISVGSFPAVATATVGSGVSLQTSSLVNSQPGTTVPAAPATQVIKAESPKTIVQA
VSQQQTLATAGQPSTTGGNMIIGQTMQAGLSNVAPNPGGIPPAAPGTPTGMAKGTANTVA
QTLPRTPTATTSGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIP
QQALAQMQAQAHAQSQPQNTMTPRPATPTSAPPVQISTVQAPGTSIIARQVTPTTIIKQV
SQAQTTVQPTTTLQRPPVVQPQIVLGGTAQTTTLGTATAVQTGTPQRTVQGTTATSTAAT
ETMENVKKCKNFLSTLIKLASSGKQSSETAANVKELVQNLLDGKIEAEDFTSRLYRELNS
SPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQQPTTQATTALTAVMLSPSVQRTAGKA
TATVTSTLQQPVISLTQPTQVGVSKQGQSTPLVIQQSQKAGTLIRPPQVTLTQTPMVALR
QPHSRIMLTTPQQIQLNQLQTVPVVKPTVLPGNKAIATVSTQVAAAQKNKLKEPGGGSFR
DDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLFSAPLQRRILEIGKKH
GITEIHPDVVSYVSHATQQRLQNLVEKLSETAQQKNISYKDDERYEQASDVRAQLKFFEQ
LDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTAL
AAIGPRKKRKVDSPGSGSGTEGSGSNAAVPGSSGVGTTRQFTRQRITRVNLRDLIFCLEN
ERETSHSLLLYKAFLK
Download sequence
Identical sequences U3J1B5
ENSAPLP00000013292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]