SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013328 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013328
Domain Number 1 Region: 1-39
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000202
Family APG12-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013328   Gene: ENSAPLG00000013522   Transcript: ENSAPLT00000014078
Sequence length 40
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743024.1:55642:56616:-1 gene:ENSAPLG00000013522 transcript:ENSAPLT00000014078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKTQAWG
Download sequence
Identical sequences U3J1F1
ENSAPLP00000013328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]