SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013339 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013339
Domain Number 1 Region: 66-144
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.99e-36
Family Forkhead DNA-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013339   Gene: ENSAPLG00000013506   Transcript: ENSAPLT00000014089
Sequence length 544
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742597.1:37138:49362:-1 gene:ENSAPLG00000013506 transcript:ENSAPLT00000014089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDLESSLTSIDWLPQLTLRATIEKLGGSSQAGPPGAARKCPPGSPTDPNATLSKDEAA
VHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWKNSIRHNLSL
NKCFRKVPRPRDDPGKGSYWTIDTCPDISRKRRHPPDDDIPQDSPEQEASKSPRGAVPVS
TEASLPSEATPQLSLQSTAPIANYSQQAAGPVDVASTVAGGQGREGADVPPPLYSANHDF
KFSYSEINFQDLSWSFRNLYKSMLEKSSSSQHGFSSLLGDMQPSNHNYYMYQQQQQQQGP
SAVGAAPPLHTPTPDGCPSQGGKQQGGESYVPPPVMSMHPPPMQHGGYHQHQQHHPHSHP
QQQPHQHQQQQQSQASINNAGFAFPDWCSNIDSLKESFKMVNRLNWSSIEHSQFSELMES
LRQAERKNWTLDQHHIANLCDSLNHFLTQTGQLPHLVGPQQPPRISDSCALNSGKQEQSM
NQVNSYGQPQPPHLFSGPSPMYQISTQDSPGYNRPAHHLVPRPPGPPPGANEEIPDDFDW
DLIT
Download sequence
Identical sequences U3J1G2
ENSAPLP00000013339 XP_005012469.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]