SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015034 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015034
Domain Number 1 Region: 7-358
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 2.75e-73
Family ADP-ribosylglycohydrolase 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015034   Gene: ENSAPLG00000015157   Transcript: ENSAPLT00000015824
Sequence length 362
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743304.1:461307:484111:1 gene:ENSAPLG00000015157 transcript:ENSAPLT00000015824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAKSVPGMDKFKAALVLAGVGDALGYRNFSRQDNALGAKIQQELKEIGGLENLVLSPDKW
PVSDNTLMHMATAEAVITDYWCLEDLYRELVRRYVDAVDKLSGRRPDPATIEGCRELKPD
NYLLAWHTPFNEKGSGFGASTKAMCLGMRYWKPERLESLIEVSIECGRMTHNHPTGFLGS
LCTALFVAYAIQGKPLVQWGREMMKVVPMAEEYCKKTIRHMAEYQEHWFYFEAKWQFYLE
EREINEENQNKPVFPDNYDAEEREKTYRRWSSEGRGGRRGHDAPMIAYDALLGCGGDWTE
LCNRSMFHGGESAATGSIAGCLYGLVYGLSKVPKGLYQDLEQRERLEYLGENLYRLSTGG
GE
Download sequence
Identical sequences U3J6A7
ENSAPLP00000015034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]