SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015723 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015723
Domain Number 1 Region: 196-253
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000331
Family Ras-binding domain, RBD 0.031
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000015723
Domain Number - Region: 253-313
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0471
Family C-terminal domain of PLC-beta 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015723   Gene: ENSAPLG00000015822   Transcript: ENSAPLT00000016524
Sequence length 330
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742633.1:32731:41443:-1 gene:ENSAPLG00000015822 transcript:ENSAPLT00000016524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYGSCEYLVPCGKDKYISKNELLLHLKTYNIYYEGQNLQLRHREEEGELIVEGLLNISW
GLRRPIRLQMQDDNQRIRPPPSSSSWHSGCNLGAHGLVLKPSTLPDIQVTDVDATMNTEG
TISSTGAARLQPEEPPQPQPPPQLLRTRSDVGVRRRGSARTPSEQRRIRRHRFSINGHFY
NHKTSVFTPAYGSVTNVRINSTMTTPQVLKLLLNKFKIENSAEEFALYIVHTSGEKQKLR
ATDYPLIARILQGPCEQVSKVFLMEKDQVEEVTYDVAQYIKFEMPVLRSFIQKLEEEEDR
EVKKLMRKYSILRLMIEQRLEEISEGPARL
Download sequence
Identical sequences U3J895
ENSAPLP00000015723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]