SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015996 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015996
Domain Number 1 Region: 51-154
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 9.15e-32
Family E2F dimerization segment 0.0016
Further Details:      
 
Domain Number 2 Region: 8-39
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000952
Family Cell cycle transcription factor e2f-dp 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015996   Gene: ENSAPLG00000016108   Transcript: ENSAPLT00000016807
Sequence length 371
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742403.1:1179297:1187738:1 gene:ENSAPLG00000016108 transcript:ENSAPLT00000016807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AADTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVGAGCNTKEVIDRLRYLESEIE
DLELKEKELDQQKLWLQQSIKNVMDDSTNHQFSYVTHEDICNCFNGDTLLAIQAPCGTQL
EVPIPEMGQNGQKKYQINLKSNSGPIHVLLINKESSSSKPVVFPVPPPDDLAQTPSQPAA
PVTPLKPTTATQNPPEQHGLNQGQQLPQTSVVDTPSGGFFPLKMGEGGLGVGKELLEKLT
DKVVGFTTTDYIMFLPVFVESSLQQNSTTPATPYSSLPDAVLYPSLSGDVAQATASSNDY
QGLLPLDPNSFDIAKMDEPTGNISGDIIDELMSSDVFPLLRLSPTPGDDYNFNLDDNEGV
CDLFDVQILNY
Download sequence
Identical sequences U3J918
ENSAPLP00000015996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]