SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289547994|ref|YP_003472982.1| from Thermocrinis albus DSM 14484

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289547994|ref|YP_003472982.1|
Domain Number 1 Region: 196-385
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.92e-67
Family B3/B4 domain of PheRS, PheT 0.00000623
Further Details:      
 
Domain Number 2 Region: 460-651
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.09e-34
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00017
Further Details:      
 
Domain Number 3 Region: 42-190
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.28e-23
Family Myf domain 0.0055
Further Details:      
 
Domain Number 4 Region: 665-759
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.57e-22
Family Anticodon-binding domain of PheRS 0.0014
Further Details:      
 
Domain Number 5 Region: 395-468
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000531
Family Domains B1 and B5 of PheRS-beta, PheT 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289547994|ref|YP_003472982.1|
Sequence length 759
Comment phenylalanyl-tRNA synthetase subunit beta [Thermocrinis albus DSM 14484]
Sequence
MIVPFSLLSQLVDTEGLKPEEIAHRLTLCSAETSLLVWERDIEGVLVGKVLSCEPHPSDI
GLLLVKVYTGRETLQVITRDGGVKEGHLVLLAPAGSFVMGKRVEKRTIGGVVSEGVLLSY
QDLKLEDSEQGVIKWMDDTPLGTSGRDLLSFGEILLEIDVTPNRGDLLSVRGVAREVAAL
FGRPMLKEDTPTFEETGSLDIEVHDGDCKRYRGVYIEKVKVGPSPLWLKKVLWQCGMKSI
NNVVDVTNYITIRDGQPLHAFDMDQVKGGIRVRSAEEGERLITLAHQEITLTKEDLVIAD
QERPLALAGVIGGLDSGVTHSTNKILLESAFFDPVRVRRSAKRHKIQTESSYRFERGVDI
EGVAFYQNSAVDLILRLAGGQLVAVKDIYPTPYTPKTIMVTIGKMERYTGKRWDLRELQK
RLEPLGFQTNLLRCGLEVKVPSWRSFDIKEDVDVLEEILRLEGYDQLPSHPLYLPARVSF
PSSEVERWADFLAHVGFREVITFSFEDDQLYHLLNLERPTLSLVNPLAKSQSYMRSSLVP
SLLRTCLYNQRNYNQQVAIFELGKVYHKDGEELRLGLLSTNLHSVEEFKNIVYRLLEGYH
LETEFSAIPFLHPHLQVLLKVEDEVIGFMGRLHPALEEKLEIKGKVLLAELRPPSSGKKR
EELGTVSPFPPVVRDISLVMDKEVSVAKLISSIRRMEGVEDVSVFDVYIDPVIIGEGKKS
VSFRLILRSNERSMSDEEANALVDRVVRLLEETYGVRLR
Download sequence
Identical sequences D3SNW8
WP_012991262.1.53471 gi|289547994|ref|YP_003472982.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]