SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289548298|ref|YP_003473286.1| from Thermocrinis albus DSM 14484

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289548298|ref|YP_003473286.1|
Domain Number 1 Region: 2-285
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.69e-104
Family Methylenetetrahydrofolate reductase 0.000000068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289548298|ref|YP_003473286.1|
Sequence length 292
Comment 5,10-methylenetetrahydrofolate reductase [Thermocrinis albus DSM 14484]
Sequence
MKIRDLLRKGFSISFEFFPPKTEEGEEELFETIRNLQSINPTFVSVTYGAGGSTREKTRR
VVERIHRETSLTVMAHLTCIAHTEEELTEILRGYREIGIENILALRGDRPKDNSATEKRG
CQYAYQLVRLIRTKFGDHFSVGVASYPEGHPESPNLEWEVRYFKMKVEEGADFSITQMFF
DNSYYYRFVELCRKEGIDIPIIPGIMPITNFRQIQRFASMCGASIPHHVVQRLEPYAHLP
QETMKVGVELAIKQCEDLIENGVPGLHFYTLNKSKATLLIYDAIKDRVPTKI
Download sequence
Identical sequences D3SPS2
WP_012991566.1.53471 gi|289548298|ref|YP_003473286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]