SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284035202|ref|YP_003385132.1| from Spirosoma linguale DSM 74

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284035202|ref|YP_003385132.1|
Domain Number 1 Region: 295-522
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.55e-38
Family ABC transporter ATPase domain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 71-292
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.57e-20
Family DNA repair protein MutS, domain III 0.0067
Further Details:      
 
Domain Number 3 Region: 729-804
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000536
Family Smr domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284035202|ref|YP_003385132.1|
Sequence length 805
Comment Smr protein/MutS2 [Spirosoma linguale DSM 74]
Sequence
MLYPNTLENKLGFDTIRERLKEACVSPLGQDYVEKIRFTDNVQLIDKLLRQTTEFKQIVQ
YEPDFPTSNYIDVRPHLSRARVEGLALTEAEFFDLKLALRTIQDCLRFLSKREEDNNFPF
LRELAGPVGVDKKLTDALERVVDDRGNIRDSASPELASIRRRIIGEQANLRKRLDSILRQ
ARQNGWIPDDLSLTVRGGRLVIPIAAEHKRKIKGFVHDESQTGQTVFLEPAEVFDANNEI
RELEYEERREIYRILLALTDQIRPHLDDLKKAVNFLAQIDFIRAKAKLAVQLDAIMPKLH
ERPLVNWTNARHPLLYLSFSKQGKTVVPLSVKLDEKARILIISGPNAGGKSVSLKTIGLI
QYMLQCGLLVPMADYAEMGVFQNLFIDIGDEQSLENDLSTYSSHLTAMKQFLIGANKRTL
FLIDEFGTGTEPGLGGAIAESILEDLNKSGAYGVVNTHYTNLKVMADKTPGLINGAMRFD
GEHLEPLYKLEIGQPGSSFAFEIAQKIGLPKGVIDRAKDKLGTQQVNFEKLLKELDIEKR
VFSEKNIEIGINQRKLAQQLAEYTALKERLDNDQKKIVNDAKQKAKALVQEANQRIENTI
REIKENKAERETTKQVRQELERFEQKELKPEPVVLETPKQAEDVFEKDNGVISAGSYVRI
AGQNTIGEVLAIRGKDAEIRIGDLKSNVKLNRLEKVSKKTFAAATEVRDDRPRSQGVDMN
EKMQNFSFNLDIRGKRGEEALGEVDRFFDDALMLGYPELRIVHGKGDGILRTLVRNHLRG
YKQVGKMEDEHADRGGAGVTIVKMK
Download sequence
Identical sequences D2QDA3
gi|284035202|ref|YP_003385132.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]