SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284036965|ref|YP_003386895.1| from Spirosoma linguale DSM 74

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284036965|ref|YP_003386895.1|
Domain Number 1 Region: 123-275
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.15e-42
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00057
Further Details:      
 
Domain Number 2 Region: 396-560
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.67e-30
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0017
Further Details:      
 
Domain Number 3 Region: 19-122
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.87e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.0075
Further Details:      
 
Domain Number 4 Region: 254-278,309-410
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.43e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284036965|ref|YP_003386895.1|
Sequence length 720
Comment sulfite reductase [Spirosoma linguale DSM 74]
Sequence
MSILLTDNVSPAARRDILDLEQKISSFRSGDIADEAFRKFRLTRGVYGQRQPGVQMIRIK
LPHGRISASQLVRIADLSDKYATGNLHATTRQDIQLHFVKLADSPQLWAELEDAGITLKE
ACGNTVRNVTGSARAGIDPLEPFDITPYAYHVFDYFLRNPICQDMGRKFKISLSSSEKDS
AYGYMHDVGLIARIQDGKRGFKVMLGGGLGAQPFSAQTAFEFLEEDRIIPFIEGVIRVFD
RYGERQKRHKARMKYLLNDIGLEELLRRIEEETPALKNKIFSVDSAPFSVSEQYADRPEV
SGYTLETENQKLNNWFKTNVFEQKQAGWYAVQLRVLLGDMHSDTARALAQIVKQYAADDI
RVTVNQGYLLRFIRPEDLPAVFEALDALGLAEPGFDTTADITTCPGTDTCNLAISSSYGI
TRALERMMHDEFPDLVFNDDIKIKISGCMNGCGQHSVANIGYHGSSLKNGAYVLPALQVL
LGGGFNGKGEGLIADKVIKIPAKRGPESLRSLLRDFEANAFDGEYYSDYYARQGKNYFYQ
LLKPIADLKTLVDSDYIDWDHTEQYVTEVGIGECASVLIDLVATTLTEASEKLGWAQEAL
AESRWADALYHAYNVFITGARAALMSRDIPTNTQHGIVSDFDKTFAVGPSHGNGAGFHEA
EGDFKALVFSINKQEPSEEFARRFIAQADTFLQAVQAYRNQQIEQEGAPELQELTQAQDS
Download sequence
Identical sequences D2QCU1
gi|284036965|ref|YP_003386895.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]