SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284038235|ref|YP_003388165.1| from Spirosoma linguale DSM 74

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284038235|ref|YP_003388165.1|
Domain Number 1 Region: 21-266,331-362
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.82e-81
Family Type II chitinase 0.0000221
Further Details:      
 
Domain Number 2 Region: 266-330
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000000135
Family Chitinase insertion domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284038235|ref|YP_003388165.1|
Sequence length 373
Comment chitinase [Spirosoma linguale DSM 74]
Sequence
MIRPVYTFLLVSFTLLLLVAFKPKPTAKPIVLAYVGGFRGLVDTEKIAAEKITHINYAFV
DVRKNRAWLHNLATDSTNFRKLNLLKRRNPDLKILISLGGWSWSENFSDAVVSDTGRVAF
AASAVDIIREYQLDGIDIDWEYPGMKGEDNVFRSEDKENFTLLFKSLREQLNSLKKQTGK
DYLVTTALPGFEAIFTHTDMAQAQQYLDYINVMSYDFFTGGPQAGHHTNLYASGKVDKES
SGDLSVKRYEQAGVPANKLLLGIAFYGRAWQLQDGNPKTHPRTITKVERGGGYTFIKDSL
LTNPAYKRHWDRRAKAPYLYNADLKRFVSYDDEKSVKAKCDYVKKNGLAGVMFWEYFSDP
KGYLLNEIDRQFL
Download sequence
Identical sequences D2QP58
gi|284038235|ref|YP_003388165.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]