SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284038974|ref|YP_003388904.1| from Spirosoma linguale DSM 74

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284038974|ref|YP_003388904.1|
Domain Number 1 Region: 14-126
Classification Level Classification E-value
Superfamily Hcp1-like 0.000000126
Family Hcp1-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284038974|ref|YP_003388904.1|
Sequence length 132
Comment hypothetical protein Slin_4118 [Spirosoma linguale DSM 74]
Sequence
MPYSSKLTLGAEKYDILGGDIGFTRSVDLKGRPSSHVMGGQFSFTIEVTDKSTLVEQMVN
SQNKPFDKGSLEFTDAGDDGVTRKIEFENAYIVNYSESFSVAGAAYTCSLTLSAEKITIQ
TAVLDQRWPVKK
Download sequence
Identical sequences D2QJQ9
gi|284038974|ref|YP_003388904.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]