SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284039585|ref|YP_003389515.1| from Spirosoma linguale DSM 74

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284039585|ref|YP_003389515.1|
Domain Number 1 Region: 230-590
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 5.09e-83
Family beta-Lactamase/D-ala carboxypeptidase 0.00087
Further Details:      
 
Domain Number 2 Region: 56-241
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 3.27e-19
Family Penicillin binding protein dimerisation domain 0.0087
Further Details:      
 
Domain Number 3 Region: 654-706
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000641
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284039585|ref|YP_003389515.1|
Sequence length 709
Comment peptidoglycan glycosyltransferase [Spirosoma linguale DSM 74]
Sequence
MNIKQDIIQRANHVFYVVIFLAVCVVFRLVSVQYFKKDLKGRFWRERVAATLIQRDTIRA
MRGNIYAHDGYLLATSLPSYVVGLDPTMAKPDYFNKKVDSLGLLLSQLYGDRSRQDYTDM
IVDARKRKRRYVLLNRRRVTFQERQKMLTWPFFRSSAKVAARGGVLRPYYERYHPYGQMA
ERTIGNLDAKTGRGLIGLEASFQPALAGKNAVGLVEVLSGGIRKPVDDGPEMKPEPGMDL
YTTIDVNYQDMAESALRSTLEKYNAAKGCVVVMEVATGEIRAMANLSRVSSTTGPNRYVE
NFNHALAGRTDPGSTFKLATMMALMEEKAISLNQLVATGDGSTRYNGIEIRDASRTGKGT
ITAREVFEKSSNVGIHMLMRSYFYKRPDLYCQYLRKFHLTQPTGIHMKGEAIPVVRNPDM
KGWSKVSLTSMSYGYEMQITPLQMLAFYNAVANGGRWVRPVLVKQIKLADELIEDNKPYV
APDPICSKETARKAQELLRGVVEHGTAKHINNPFYAIAGKTGTAQKVINGKYQVGRYYTS
FIGYFPANNPKYSMITVVDNPEGDNIDMLYAGAVAAPVFKAVADRIVAYDYQMHAPIRVR
ASRPQSTTDVVAGYADDLHVIGSTLNMRNEPSTEGWVEATPRGGWKARPTRTDRVPDVRG
LTLRDALYLLENRGFRVLVDGRGKVKEQSVEPGTGIEKAAGKVITLTLG
Download sequence
Identical sequences D2QPQ7
gi|284039585|ref|YP_003389515.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]