SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284040242|ref|YP_003390172.1| from Spirosoma linguale DSM 74

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284040242|ref|YP_003390172.1|
Domain Number 1 Region: 634-807
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.68e-48
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 4-194
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.38e-36
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0032
Further Details:      
 
Domain Number 3 Region: 503-642
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.29e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.017
Further Details:      
 
Domain Number 4 Region: 153-312
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.12e-26
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0057
Further Details:      
 
Weak hits

Sequence:  gi|284040242|ref|YP_003390172.1|
Domain Number - Region: 428-469
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0802
Family Retrovirus zinc finger-like domains 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284040242|ref|YP_003390172.1|
Sequence length 837
Comment nitrite reductase (NAD(P)H) large subunit [Spirosoma linguale DSM 74]
Sequence
MNTNKNRRVVVIGNGMVGYKFCEKLVAKEKNDQRFTLTVFGEEPRVAYDRVHLSAYFDGK
TADDLTLAPQSWYADNGITLYLTDPVVNIDRERKEVRSHHGVVVPYDYLVLATGSGAFVP
PVAGVEKDGVFVYRTIEDLDLIQSYARKARKGAVLGGGLLGLEAAKALLDLGLDEAHVVE
FAPRLMPRQIDDAGSGILQHQLESLGLNIHLSKSTQEITGDEAITGMQFADGSHLAVDML
VISAGIRPRDELAKSAGLDTHPRGGILVDNFLQTSDSSIFAIGECAVVHHMIYGLVAPGY
EMAEVVASRLIGEEKEFKPYDMSTKLKLIGTDVGSFGDPFASDCKTIVYENKAKGVYKRV
NISVDGKELLGGILVGDAEQYNMLLQTCKNKTILPPDPEDLILGSRGGEEAGAGVMSLPD
DALICSCEAITKAMLCHEIGENGHTTVDALKKATRACTGCGGCTPMVKDIIQGVLKQKGV
YVRNILCEHFDFTRQELLDLVKINSLKTFDAVLDKVGKGDGCEVCKPAVASILASLWNEN
ILEQGRATIQDSNDRFLANIQKGGTYSVVPRIPGGEITPDKLIVIGQVAKKYGLYTKITG
GQRIDLFGAHVGDLPVIWEELIAAGFESGHAYGKSLRTVKSCVGSTWCRFGVQDSVSFAI
EVEERYKGIRSPHKLKSGVSGCIRECAEAQSKDFGIIATEKGWNLYVGGNGGSKPQHAIL
LASDVDKETCIRYIDRFLMFYIKTADPLTRTATWLNKMDGGMNYLRAVVVDDVLNIADEL
EREMQLLVDTFKCEWKEAVENPALRARFAHFVNAPEQKDPTVQFDALRDQKRAKEWA
Download sequence
Identical sequences D2QF29
gi|284040242|ref|YP_003390172.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]