SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284039737|ref|YP_003389667.1| from Spirosoma linguale DSM 74

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284039737|ref|YP_003389667.1|
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily YjgF-like 1.37e-41
Family YjgF/L-PSP 0.000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284039737|ref|YP_003389667.1|
Sequence length 122
Comment endoribonuclease L-PSP [Spirosoma linguale DSM 74]
Sequence
MSKQIVYTDEAPAPIGPYSQAVKINGTLFVSGQVAIELSTQGDIQAETQKVMENIGAILK
AAGMDYPNVVKSSIFVKDMNNFAAINEVYGRFFTENPPARETVEVARLPKDVNVEISVIA
VQ
Download sequence
Identical sequences D2QRG3
gi|284039737|ref|YP_003389667.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]